PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 365aa    MW: 40466.9 Da    PI: 4.4308
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002296genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +l++ +  +G  +W+++++  g+ R++k+c++rw +yl
      Lus10002296 14 KGPWTADEDRKLINFILTHGQCCWRAVPKLSGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.82.1e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d+++qlG++ W++Ia+ m+ gRt++++k++w+++
      Lus10002296  70 LSESEEKLVIDLHAQLGNR-WSKIASQMP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-20563IPR009057Homeodomain-like
PROSITE profilePS5129414.216961IPR017930Myb domain
SuperFamilySSF466897.49E-2711108IPR009057Homeodomain-like
SMARTSM007176.6E-131363IPR001005SANT/Myb domain
PfamPF002499.6E-141461IPR001005SANT/Myb domain
CDDcd001672.22E-91661No hitNo description
PROSITE profilePS5129426.53362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2464116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002494.6E-1570111IPR001005SANT/Myb domain
CDDcd001677.66E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAD EDRKLINFIL THGQCCWRAV PKLSGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SESEEKLVID LHAQLGNRWS KIASQMPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHQHLP PTTTTGTDTT PHEQQEQHSS SKDIISTNEQ DPVVLNTVSP ESATEATSPL  180
MSSISSSSSS STIVDDDLQS AITQLANQLD VPDYHNAVEG VLSYDDIAGF SLEDVPLVEF  240
EPHEIITNDC SRTNNINIDI DAEFLPPANL SSSSSSCTDN HTDDSANAGR RNDYTILEAA  300
EDDCWWASQL TTKEGQLMDL WADEDLGCWD LAVNDEINCE IQMMAASLGS CLDAVDDYSS  360
WTCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616278.18e-92myb transcription factor
STRINGGLYMA14G39530.18e-89(Glycine max)
STRINGSolyc11g011050.1.15e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-82myb domain protein 20